Anti MFSD11 pAb (ATL-HPA022001)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022001-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: MFSD11
Alternative Gene Name: FLJ20226, FLJ22196
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020818: 81%, ENSRNOG00000000247: 83%
Entrez Gene ID: 79157
Uniprot ID: O43934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DSENVLGEDESSDDQDMEVNESAQNNLTKAVDAFKKSFKLCVTKEML |
| Gene Sequence | DSENVLGEDESSDDQDMEVNESAQNNLTKAVDAFKKSFKLCVTKEML |
| Gene ID - Mouse | ENSMUSG00000020818 |
| Gene ID - Rat | ENSRNOG00000000247 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MFSD11 pAb (ATL-HPA022001) | |
| Datasheet | Anti MFSD11 pAb (ATL-HPA022001) Datasheet (External Link) |
| Vendor Page | Anti MFSD11 pAb (ATL-HPA022001) at Atlas Antibodies |
| Documents & Links for Anti MFSD11 pAb (ATL-HPA022001) | |
| Datasheet | Anti MFSD11 pAb (ATL-HPA022001) Datasheet (External Link) |
| Vendor Page | Anti MFSD11 pAb (ATL-HPA022001) |
| Citations for Anti MFSD11 pAb (ATL-HPA022001) – 3 Found |
| Perland, Emelie; Lekholm, Emilia; Eriksson, Mikaela M; Bagchi, Sonchita; Arapi, Vasiliki; Fredriksson, Robert. The Putative SLC Transporters Mfsd5 and Mfsd11 Are Abundantly Expressed in the Mouse Brain and Have a Potential Role in Energy Homeostasis. Plos One. 11(6):e0156912. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Perland, Emelie; Bagchi, Sonchita; Klaesson, Axel; Fredriksson, Robert. Characteristics of 29 novel atypical solute carriers of major facilitator superfamily type: evolutionary conservation, predicted structure and neuronal co-expression. Open Biology. 2017;7(9) PubMed |