Anti MFNG pAb (ATL-HPA048936)

Atlas Antibodies

Catalog No.:
ATL-HPA048936-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Gene Name: MFNG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018169: 85%, ENSRNOG00000008133: 88%
Entrez Gene ID: 4242
Uniprot ID: O00587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLAS
Gene Sequence TTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLAS
Gene ID - Mouse ENSMUSG00000018169
Gene ID - Rat ENSRNOG00000008133
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MFNG pAb (ATL-HPA048936)
Datasheet Anti MFNG pAb (ATL-HPA048936) Datasheet (External Link)
Vendor Page Anti MFNG pAb (ATL-HPA048936) at Atlas Antibodies

Documents & Links for Anti MFNG pAb (ATL-HPA048936)
Datasheet Anti MFNG pAb (ATL-HPA048936) Datasheet (External Link)
Vendor Page Anti MFNG pAb (ATL-HPA048936)