Anti MFAP4 pAb (ATL-HPA054097)

Atlas Antibodies

Catalog No.:
ATL-HPA054097-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: microfibrillar-associated protein 4
Gene Name: MFAP4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042436: 92%, ENSRNOG00000002382: 90%
Entrez Gene ID: 4239
Uniprot ID: P55083
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTT
Gene Sequence SGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTT
Gene ID - Mouse ENSMUSG00000042436
Gene ID - Rat ENSRNOG00000002382
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MFAP4 pAb (ATL-HPA054097)
Datasheet Anti MFAP4 pAb (ATL-HPA054097) Datasheet (External Link)
Vendor Page Anti MFAP4 pAb (ATL-HPA054097) at Atlas Antibodies

Documents & Links for Anti MFAP4 pAb (ATL-HPA054097)
Datasheet Anti MFAP4 pAb (ATL-HPA054097) Datasheet (External Link)
Vendor Page Anti MFAP4 pAb (ATL-HPA054097)