Anti MFAP3L pAb (ATL-HPA062306)

Atlas Antibodies

Catalog No.: ATL-HPA062306-100

Protein Description: microfibril associated protein 3 like
Gene Name: MFAP3L
Alternative Gene Name: KIAA0626, NYD-sp9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031647: 79%, ENSRNOG00000011775: 76%
Entrez Gene ID: 9848
Uniprot ID: O75121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEGGQFEVKDVEETELSAEHSPETAEPSTDVTSTELTSEEPTPVEVPDKVLPPAYLEATEPAVTHDKNTCIIYESH
• Gene Sequence: QEGGQFEVKDVEETELSAEHSPETAEPSTDVTSTELTSEEPTPVEVPDKVLPPAYLEATEPAVTHDKNTCIIYESH
• Gene ID - Mouse: ENSMUSG00000031647
• Gene ID - Rat: ENSRNOG00000011775
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.