Anti METTL8 pAb (ATL-HPA035421)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035421-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: METTL8
Alternative Gene Name: FLJ13984, TIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041975: 83%, ENSRNOG00000009382: 82%
Entrez Gene ID: 79828
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEE |
| Gene Sequence | MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEE |
| Gene ID - Mouse | ENSMUSG00000041975 |
| Gene ID - Rat | ENSRNOG00000009382 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti METTL8 pAb (ATL-HPA035421) | |
| Datasheet | Anti METTL8 pAb (ATL-HPA035421) Datasheet (External Link) |
| Vendor Page | Anti METTL8 pAb (ATL-HPA035421) at Atlas Antibodies |
| Documents & Links for Anti METTL8 pAb (ATL-HPA035421) | |
| Datasheet | Anti METTL8 pAb (ATL-HPA035421) Datasheet (External Link) |
| Vendor Page | Anti METTL8 pAb (ATL-HPA035421) |