Anti METTL8 pAb (ATL-HPA035421)

Atlas Antibodies

Catalog No.:
ATL-HPA035421-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 8
Gene Name: METTL8
Alternative Gene Name: FLJ13984, TIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041975: 83%, ENSRNOG00000009382: 82%
Entrez Gene ID: 79828
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEE
Gene Sequence MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEE
Gene ID - Mouse ENSMUSG00000041975
Gene ID - Rat ENSRNOG00000009382
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti METTL8 pAb (ATL-HPA035421)
Datasheet Anti METTL8 pAb (ATL-HPA035421) Datasheet (External Link)
Vendor Page Anti METTL8 pAb (ATL-HPA035421) at Atlas Antibodies

Documents & Links for Anti METTL8 pAb (ATL-HPA035421)
Datasheet Anti METTL8 pAb (ATL-HPA035421) Datasheet (External Link)
Vendor Page Anti METTL8 pAb (ATL-HPA035421)