Anti METTL27 pAb (ATL-HPA074662)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074662-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: METTL27
Alternative Gene Name: WBSCR27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040557: 80%, ENSRNOG00000046700: 78%
Entrez Gene ID: 155368
Uniprot ID: Q8N6F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPEL |
| Gene Sequence | RAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPEL |
| Gene ID - Mouse | ENSMUSG00000040557 |
| Gene ID - Rat | ENSRNOG00000046700 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti METTL27 pAb (ATL-HPA074662) | |
| Datasheet | Anti METTL27 pAb (ATL-HPA074662) Datasheet (External Link) |
| Vendor Page | Anti METTL27 pAb (ATL-HPA074662) at Atlas Antibodies |
| Documents & Links for Anti METTL27 pAb (ATL-HPA074662) | |
| Datasheet | Anti METTL27 pAb (ATL-HPA074662) Datasheet (External Link) |
| Vendor Page | Anti METTL27 pAb (ATL-HPA074662) |