Anti METTL27 pAb (ATL-HPA074662)

Atlas Antibodies

Catalog No.:
ATL-HPA074662-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 27
Gene Name: METTL27
Alternative Gene Name: WBSCR27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040557: 80%, ENSRNOG00000046700: 78%
Entrez Gene ID: 155368
Uniprot ID: Q8N6F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPEL
Gene Sequence RAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPEL
Gene ID - Mouse ENSMUSG00000040557
Gene ID - Rat ENSRNOG00000046700
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti METTL27 pAb (ATL-HPA074662)
Datasheet Anti METTL27 pAb (ATL-HPA074662) Datasheet (External Link)
Vendor Page Anti METTL27 pAb (ATL-HPA074662) at Atlas Antibodies

Documents & Links for Anti METTL27 pAb (ATL-HPA074662)
Datasheet Anti METTL27 pAb (ATL-HPA074662) Datasheet (External Link)
Vendor Page Anti METTL27 pAb (ATL-HPA074662)