Anti METTL25 pAb (ATL-HPA041207)

Atlas Antibodies

Catalog No.:
ATL-HPA041207-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 25
Gene Name: METTL25
Alternative Gene Name: C12orf26, FLJ22789
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036009: 89%, ENSRNOG00000027451: 89%
Entrez Gene ID: 84190
Uniprot ID: Q8N6Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCHYLKEERWCCGRNARMSACLALERVAAGQGLPTESLFYRAVLQDIIKDCYGITKCDRHVGKIYSKCSSFLDYVRRSLKK
Gene Sequence MCHYLKEERWCCGRNARMSACLALERVAAGQGLPTESLFYRAVLQDIIKDCYGITKCDRHVGKIYSKCSSFLDYVRRSLKK
Gene ID - Mouse ENSMUSG00000036009
Gene ID - Rat ENSRNOG00000027451
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti METTL25 pAb (ATL-HPA041207)
Datasheet Anti METTL25 pAb (ATL-HPA041207) Datasheet (External Link)
Vendor Page Anti METTL25 pAb (ATL-HPA041207) at Atlas Antibodies

Documents & Links for Anti METTL25 pAb (ATL-HPA041207)
Datasheet Anti METTL25 pAb (ATL-HPA041207) Datasheet (External Link)
Vendor Page Anti METTL25 pAb (ATL-HPA041207)