Anti METTL25 pAb (ATL-HPA039534)

Atlas Antibodies

Catalog No.: ATL-HPA039534-25

Protein Description: methyltransferase like 25
Gene Name: METTL25
Alternative Gene Name: C12orf26, FLJ22789
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036009: 76%, ENSRNOG00000027451: 74%
Entrez Gene ID: 84190
Uniprot ID: Q8N6Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGRCYHLLSEEFENQHKERTQEKW
• Gene Sequence: TSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGRCYHLLSEEFENQHKERTQEKW
• Gene ID - Mouse: ENSMUSG00000036009
• Gene ID - Rat: ENSRNOG00000027451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.