Anti METTL25 pAb (ATL-HPA039534)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039534-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: METTL25
Alternative Gene Name: C12orf26, FLJ22789
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036009: 76%, ENSRNOG00000027451: 74%
Entrez Gene ID: 84190
Uniprot ID: Q8N6Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGRCYHLLSEEFENQHKERTQEKW |
| Gene Sequence | TSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGRCYHLLSEEFENQHKERTQEKW |
| Gene ID - Mouse | ENSMUSG00000036009 |
| Gene ID - Rat | ENSRNOG00000027451 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti METTL25 pAb (ATL-HPA039534) | |
| Datasheet | Anti METTL25 pAb (ATL-HPA039534) Datasheet (External Link) |
| Vendor Page | Anti METTL25 pAb (ATL-HPA039534) at Atlas Antibodies |
| Documents & Links for Anti METTL25 pAb (ATL-HPA039534) | |
| Datasheet | Anti METTL25 pAb (ATL-HPA039534) Datasheet (External Link) |
| Vendor Page | Anti METTL25 pAb (ATL-HPA039534) |