Anti METTL12 pAb (ATL-HPA038115)

Atlas Antibodies

Catalog No.:
ATL-HPA038115-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 12
Gene Name: METTL12
Alternative Gene Name: U99HG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022842: 25%, ENSRNOG00000029529: 26%
Entrez Gene ID: 751071
Uniprot ID: A8MUP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTWDAVARGGLPRAYQLLSECLRVLNPQGTLIQFSDEDPDVRLPCLEQGSYGWTVTVQELGPFRGITYFAY
Gene Sequence GTWDAVARGGLPRAYQLLSECLRVLNPQGTLIQFSDEDPDVRLPCLEQGSYGWTVTVQELGPFRGITYFAY
Gene ID - Mouse ENSMUSG00000022842
Gene ID - Rat ENSRNOG00000029529
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti METTL12 pAb (ATL-HPA038115)
Datasheet Anti METTL12 pAb (ATL-HPA038115) Datasheet (External Link)
Vendor Page Anti METTL12 pAb (ATL-HPA038115) at Atlas Antibodies

Documents & Links for Anti METTL12 pAb (ATL-HPA038115)
Datasheet Anti METTL12 pAb (ATL-HPA038115) Datasheet (External Link)
Vendor Page Anti METTL12 pAb (ATL-HPA038115)