Anti MEPE pAb (ATL-HPA038004)

Atlas Antibodies

Catalog No.: ATL-HPA038004-25

Protein Description: matrix extracellular phosphoglycoprotein
Gene Name: MEPE
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053863: 53%, ENSRNOG00000002154: 48%
Entrez Gene ID: 56955
Uniprot ID: Q9NQ76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPASMNYAKAHSKDKKKPQRDSQAQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQERGDNDISPFSGDGQPFKDIPGKGEATGPD
• Gene Sequence: IPASMNYAKAHSKDKKKPQRDSQAQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQERGDNDISPFSGDGQPFKDIPGKGEATGPD
• Gene ID - Mouse: ENSMUSG00000053863
• Gene ID - Rat: ENSRNOG00000002154
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MEPE pAb (ATL-HPA038004) – 1 Found

Malhan, Deeksha; Schmidt-Bleek, Katharina; Duda, Georg N; El Khassawna, Thaqif. Landscape of Well-Coordinated Fracture Healing in a Mouse Model Using Molecular and Cellular Analysis. International Journal Of Molecular Sciences. 2023;24(4)