Anti MEMO1 pAb (ATL-HPA042603)

Atlas Antibodies

Catalog No.:
ATL-HPA042603-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mediator of cell motility 1
Gene Name: MEMO1
Alternative Gene Name: C2orf4, CGI-27, MEMO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058704: 100%, ENSRNOG00000006340: 100%
Entrez Gene ID: 51072
Uniprot ID: Q9Y316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAK
Gene Sequence FILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAK
Gene ID - Mouse ENSMUSG00000058704
Gene ID - Rat ENSRNOG00000006340
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MEMO1 pAb (ATL-HPA042603)
Datasheet Anti MEMO1 pAb (ATL-HPA042603) Datasheet (External Link)
Vendor Page Anti MEMO1 pAb (ATL-HPA042603) at Atlas Antibodies

Documents & Links for Anti MEMO1 pAb (ATL-HPA042603)
Datasheet Anti MEMO1 pAb (ATL-HPA042603) Datasheet (External Link)
Vendor Page Anti MEMO1 pAb (ATL-HPA042603)