Anti MEMO1 pAb (ATL-HPA042603)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042603-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MEMO1
Alternative Gene Name: C2orf4, CGI-27, MEMO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058704: 100%, ENSRNOG00000006340: 100%
Entrez Gene ID: 51072
Uniprot ID: Q9Y316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAK |
| Gene Sequence | FILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAK |
| Gene ID - Mouse | ENSMUSG00000058704 |
| Gene ID - Rat | ENSRNOG00000006340 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MEMO1 pAb (ATL-HPA042603) | |
| Datasheet | Anti MEMO1 pAb (ATL-HPA042603) Datasheet (External Link) |
| Vendor Page | Anti MEMO1 pAb (ATL-HPA042603) at Atlas Antibodies |
| Documents & Links for Anti MEMO1 pAb (ATL-HPA042603) | |
| Datasheet | Anti MEMO1 pAb (ATL-HPA042603) Datasheet (External Link) |
| Vendor Page | Anti MEMO1 pAb (ATL-HPA042603) |