Anti MED31 pAb (ATL-HPA035947)

Atlas Antibodies

Catalog No.: ATL-HPA035947-25

Protein Description: mediator complex subunit 31
Gene Name: MED31
Alternative Gene Name: CGI-125, Soh1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020801: 99%, ENSRNOG00000014618: 99%
Entrez Gene ID: 51003
Uniprot ID: Q9Y3C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQC
• Gene Sequence: AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQC
• Gene ID - Mouse: ENSMUSG00000020801
• Gene ID - Rat: ENSRNOG00000014618
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.