Anti MED28 pAb (ATL-HPA035901)

Atlas Antibodies

Catalog No.:
ATL-HPA035901-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 28
Gene Name: MED28
Alternative Gene Name: DKFZP434N185, EG1, magicin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015804: 97%, ENSRNOG00000003592: 97%
Entrez Gene ID: 80306
Uniprot ID: Q9H204
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQV
Gene Sequence PSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQV
Gene ID - Mouse ENSMUSG00000015804
Gene ID - Rat ENSRNOG00000003592
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MED28 pAb (ATL-HPA035901)
Datasheet Anti MED28 pAb (ATL-HPA035901) Datasheet (External Link)
Vendor Page Anti MED28 pAb (ATL-HPA035901) at Atlas Antibodies

Documents & Links for Anti MED28 pAb (ATL-HPA035901)
Datasheet Anti MED28 pAb (ATL-HPA035901) Datasheet (External Link)
Vendor Page Anti MED28 pAb (ATL-HPA035901)