Anti MED28 pAb (ATL-HPA035901)

Atlas Antibodies

Catalog No.: ATL-HPA035901-25

Protein Description: mediator complex subunit 28
Gene Name: MED28
Alternative Gene Name: DKFZP434N185, EG1, magicin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015804: 97%, ENSRNOG00000003592: 97%
Entrez Gene ID: 80306
Uniprot ID: Q9H204
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQV
• Gene Sequence: PSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQV
• Gene ID - Mouse: ENSMUSG00000015804
• Gene ID - Rat: ENSRNOG00000003592
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.