Anti MED12 pAb (ATL-HPA003184 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003184-25

Protein Description: mediator complex subunit 12
Gene Name: MED12
Alternative Gene Name: CAGH45, FGS1, HOPA, KIAA0192, OKS, OPA1, TNRC11, TRAP230
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079487: 94%, ENSRNOG00000003848: 94%
Entrez Gene ID: 9968
Uniprot ID: Q93074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAPTLLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQ
• Gene Sequence: RLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAPTLLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQ
• Gene ID - Mouse: ENSMUSG00000079487
• Gene ID - Rat: ENSRNOG00000003848
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MED12 pAb (ATL-HPA003184 w/enhanced validation) – 3 Found

Wu, Xin; Serna, Vanida A; Thomas, Justin; Qiang, Wenan; Blumenfeld, Michael L; Kurita, Takeshi. Subtype-Specific Tumor-Associated Fibroblasts Contribute to the Pathogenesis of Uterine Leiomyoma. Cancer Research. 2017;77(24):6891-6901. 

Serna, Vanida A; Wu, Xin; Qiang, Wenan; Thomas, Justin; Blumenfeld, Michael L; Kurita, Takeshi. Cellular kinetics of MED12-mutant uterine leiomyoma growth and regression in vivo. Endocrine-Related Cancer. 2018;25(7):747-759. 

Pérot, Gaëlle; Croce, Sabrina; Ribeiro, Agnès; Lagarde, Pauline; Velasco, Valérie; Neuville, Agnès; Coindre, Jean-Michel; Stoeckle, Eberhard; Floquet, Anne; MacGrogan, Gaëtan; Chibon, Frédéric. MED12 alterations in both human benign and malignant uterine soft tissue tumors. Plos One. 7(6):e40015.