Anti ME2 pAb (ATL-HPA008880 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008880-25

Protein Description: malic enzyme 2, NAD(+)-dependent, mitochondrial
Gene Name: ME2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024556: 83%, ENSRNOG00000015582: 80%
Entrez Gene ID: 4200
Uniprot ID: P23368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTA
• Gene Sequence: KVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTA
• Gene ID - Mouse: ENSMUSG00000024556
• Gene ID - Rat: ENSRNOG00000015582
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ME2 pAb (ATL-HPA008880 w/enhanced validation) – 4 Found

MacDonald, Michael J; Longacre, Melissa J; Kendrick, Mindy A. Mitochondrial malic enzyme (ME2) in pancreatic islets of the human, rat and mouse and clonal insulinoma cells. Archives Of Biochemistry And Biophysics. 2009;488(2):100-4. 

Zoccarato, Franco; Cavallini, Lucia; Alexandre, Adolfo. Succinate is the controller of O2-/H2O2 release at mitochondrial complex I : negative modulation by malate, positive by cyanide. Journal Of Bioenergetics And Biomembranes. 2009;41(4):387-93. 

Brown, Laura J; Longacre, Melissa J; Hasan, Noaman M; Kendrick, Mindy A; Stoker, Scott W; Macdonald, Michael J. Chronic reduction of the cytosolic or mitochondrial NAD(P)-malic enzyme does not affect insulin secretion in a rat insulinoma cell line. The Journal Of Biological Chemistry. 2009;284(51):35359-67. 

Hasan, Noaman M; Longacre, Melissa J; Stoker, Scott W; Kendrick, Mindy A; MacDonald, Michael J. Mitochondrial malic enzyme 3 is important for insulin secretion in pancreatic β-cells. Molecular Endocrinology (Baltimore, Md.). 2015;29(3):396-410.