Anti MDGA1 pAb (ATL-HPA050382)

Atlas Antibodies

Catalog No.:
ATL-HPA050382-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: MAM domain containing glycosylphosphatidylinositol anchor 1
Gene Name: MDGA1
Alternative Gene Name: GPIM, MAMDC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043557: 93%, ENSRNOG00000000536: 93%
Entrez Gene ID: 266727
Uniprot ID: Q8NFP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDHAELRLDAVTRDSSGSYECSVSNDVGSAA
Gene Sequence EVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDHAELRLDAVTRDSSGSYECSVSNDVGSAA
Gene ID - Mouse ENSMUSG00000043557
Gene ID - Rat ENSRNOG00000000536
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MDGA1 pAb (ATL-HPA050382)
Datasheet Anti MDGA1 pAb (ATL-HPA050382) Datasheet (External Link)
Vendor Page Anti MDGA1 pAb (ATL-HPA050382) at Atlas Antibodies

Documents & Links for Anti MDGA1 pAb (ATL-HPA050382)
Datasheet Anti MDGA1 pAb (ATL-HPA050382) Datasheet (External Link)
Vendor Page Anti MDGA1 pAb (ATL-HPA050382)