Anti MCRIP1 pAb (ATL-HPA045542)

Atlas Antibodies

Catalog No.: ATL-HPA045542-25

Protein Description: MAPK regulated corepressor interacting protein 1
Gene Name: MCRIP1
Alternative Gene Name: FAM195B, GRAN2, MCRIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061111: 90%, ENSRNOG00000036691: 90%
Entrez Gene ID: 348262
Uniprot ID: C9JLW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS
• Gene Sequence: VRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS
• Gene ID - Mouse: ENSMUSG00000061111
• Gene ID - Rat: ENSRNOG00000036691
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MCRIP1 pAb (ATL-HPA045542) – 1 Found

Bish, Rebecca; Cuevas-Polo, Nerea; Cheng, Zhe; Hambardzumyan, Dolores; Munschauer, Mathias; Landthaler, Markus; Vogel, Christine. Comprehensive Protein Interactome Analysis of a Key RNA Helicase: Detection of Novel Stress Granule Proteins. Biomolecules. 2015;5(3):1441-66.