Anti MCRIP1 pAb (ATL-HPA045542)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045542-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MCRIP1
Alternative Gene Name: FAM195B, GRAN2, MCRIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061111: 90%, ENSRNOG00000036691: 90%
Entrez Gene ID: 348262
Uniprot ID: C9JLW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS |
Gene Sequence | VRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS |
Gene ID - Mouse | ENSMUSG00000061111 |
Gene ID - Rat | ENSRNOG00000036691 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MCRIP1 pAb (ATL-HPA045542) | |
Datasheet | Anti MCRIP1 pAb (ATL-HPA045542) Datasheet (External Link) |
Vendor Page | Anti MCRIP1 pAb (ATL-HPA045542) at Atlas Antibodies |
Documents & Links for Anti MCRIP1 pAb (ATL-HPA045542) | |
Datasheet | Anti MCRIP1 pAb (ATL-HPA045542) Datasheet (External Link) |
Vendor Page | Anti MCRIP1 pAb (ATL-HPA045542) |
Citations for Anti MCRIP1 pAb (ATL-HPA045542) – 1 Found |
Bish, Rebecca; Cuevas-Polo, Nerea; Cheng, Zhe; Hambardzumyan, Dolores; Munschauer, Mathias; Landthaler, Markus; Vogel, Christine. Comprehensive Protein Interactome Analysis of a Key RNA Helicase: Detection of Novel Stress Granule Proteins. Biomolecules. 2015;5(3):1441-66. PubMed |