Anti MCRIP1 pAb (ATL-HPA045542)

Atlas Antibodies

Catalog No.:
ATL-HPA045542-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: MAPK regulated corepressor interacting protein 1
Gene Name: MCRIP1
Alternative Gene Name: FAM195B, GRAN2, MCRIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061111: 90%, ENSRNOG00000036691: 90%
Entrez Gene ID: 348262
Uniprot ID: C9JLW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS
Gene Sequence VRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS
Gene ID - Mouse ENSMUSG00000061111
Gene ID - Rat ENSRNOG00000036691
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MCRIP1 pAb (ATL-HPA045542)
Datasheet Anti MCRIP1 pAb (ATL-HPA045542) Datasheet (External Link)
Vendor Page Anti MCRIP1 pAb (ATL-HPA045542) at Atlas Antibodies

Documents & Links for Anti MCRIP1 pAb (ATL-HPA045542)
Datasheet Anti MCRIP1 pAb (ATL-HPA045542) Datasheet (External Link)
Vendor Page Anti MCRIP1 pAb (ATL-HPA045542)
Citations for Anti MCRIP1 pAb (ATL-HPA045542) – 1 Found
Bish, Rebecca; Cuevas-Polo, Nerea; Cheng, Zhe; Hambardzumyan, Dolores; Munschauer, Mathias; Landthaler, Markus; Vogel, Christine. Comprehensive Protein Interactome Analysis of a Key RNA Helicase: Detection of Novel Stress Granule Proteins. Biomolecules. 2015;5(3):1441-66.  PubMed