Anti MCOLN2 pAb (ATL-HPA048999)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048999-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MCOLN2
Alternative Gene Name: FLJ36691, TRP-ML2, TRPML2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011008: 36%, ENSRNOG00000015089: 36%
Entrez Gene ID: 255231
Uniprot ID: Q8IZK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MARQPYRFPQARIPERGSGVFRLTVRNAMAHRDSEMKEECLREDLKF |
Gene Sequence | MARQPYRFPQARIPERGSGVFRLTVRNAMAHRDSEMKEECLREDLKF |
Gene ID - Mouse | ENSMUSG00000011008 |
Gene ID - Rat | ENSRNOG00000015089 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MCOLN2 pAb (ATL-HPA048999) | |
Datasheet | Anti MCOLN2 pAb (ATL-HPA048999) Datasheet (External Link) |
Vendor Page | Anti MCOLN2 pAb (ATL-HPA048999) at Atlas Antibodies |
Documents & Links for Anti MCOLN2 pAb (ATL-HPA048999) | |
Datasheet | Anti MCOLN2 pAb (ATL-HPA048999) Datasheet (External Link) |
Vendor Page | Anti MCOLN2 pAb (ATL-HPA048999) |