Anti MCOLN2 pAb (ATL-HPA048999)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048999-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MCOLN2
Alternative Gene Name: FLJ36691, TRP-ML2, TRPML2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011008: 36%, ENSRNOG00000015089: 36%
Entrez Gene ID: 255231
Uniprot ID: Q8IZK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MARQPYRFPQARIPERGSGVFRLTVRNAMAHRDSEMKEECLREDLKF |
| Gene Sequence | MARQPYRFPQARIPERGSGVFRLTVRNAMAHRDSEMKEECLREDLKF |
| Gene ID - Mouse | ENSMUSG00000011008 |
| Gene ID - Rat | ENSRNOG00000015089 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MCOLN2 pAb (ATL-HPA048999) | |
| Datasheet | Anti MCOLN2 pAb (ATL-HPA048999) Datasheet (External Link) |
| Vendor Page | Anti MCOLN2 pAb (ATL-HPA048999) at Atlas Antibodies |
| Documents & Links for Anti MCOLN2 pAb (ATL-HPA048999) | |
| Datasheet | Anti MCOLN2 pAb (ATL-HPA048999) Datasheet (External Link) |
| Vendor Page | Anti MCOLN2 pAb (ATL-HPA048999) |