Anti MCOLN1 pAb (ATL-HPA031763)

Atlas Antibodies

Catalog No.: ATL-HPA031763-25

Protein Description: mucolipin 1
Gene Name: MCOLN1
Alternative Gene Name: ML4, MLIV, MST080, MSTP080, TRPM-L1, TRPML1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004567: 87%, ENSRNOG00000000975: 85%
Entrez Gene ID: 57192
Uniprot ID: Q9GZU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTIKHPGGAGAEESELQAYIAQCQDSPTSGKFRRGSGSACSLLCCCGRDPSE
• Gene Sequence: DTIKHPGGAGAEESELQAYIAQCQDSPTSGKFRRGSGSACSLLCCCGRDPSE
• Gene ID - Mouse: ENSMUSG00000004567
• Gene ID - Rat: ENSRNOG00000000975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MCOLN1 pAb (ATL-HPA031763) – 1 Found

Hui, Liang; Soliman, Mahmoud L; Geiger, Nicholas H; Miller, Nicole M; Afghah, Zahra; Lakpa, Koffi L; Chen, Xuesong; Geiger, Jonathan D. Acidifying Endolysosomes Prevented Low-Density Lipoprotein-Induced Amyloidogenesis. Journal Of Alzheimer's Disease : Jad. 67(1):393-410.