Anti MCM9 pAb (ATL-HPA031137)

Atlas Antibodies

Catalog No.: ATL-HPA031137-25

Protein Description: minichromosome maintenance complex component 9
Gene Name: MCM9
Alternative Gene Name: C6orf61, dJ329L24.3, FLJ20170, MCMDC1, MGC35304
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058298: 47%, ENSRNOG00000003281: 53%
Entrez Gene ID: 254394
Uniprot ID: Q9NXL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPPPERKNRGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESLFTLPELGDEAFDCDWD
• Gene Sequence: SPPPERKNRGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESLFTLPELGDEAFDCDWD
• Gene ID - Mouse: ENSMUSG00000058298
• Gene ID - Rat: ENSRNOG00000003281
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.