Anti MCL1 pAb (ATL-HPA031125)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031125-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: MCL1
Alternative Gene Name: BCL2L3, Mcl-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038612: 89%, ENSRNOG00000002791: 26%
Entrez Gene ID: 4170
Uniprot ID: Q07820
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR |
| Gene Sequence | MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR |
| Gene ID - Mouse | ENSMUSG00000038612 |
| Gene ID - Rat | ENSRNOG00000002791 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MCL1 pAb (ATL-HPA031125) | |
| Datasheet | Anti MCL1 pAb (ATL-HPA031125) Datasheet (External Link) |
| Vendor Page | Anti MCL1 pAb (ATL-HPA031125) at Atlas Antibodies |
| Documents & Links for Anti MCL1 pAb (ATL-HPA031125) | |
| Datasheet | Anti MCL1 pAb (ATL-HPA031125) Datasheet (External Link) |
| Vendor Page | Anti MCL1 pAb (ATL-HPA031125) |