Anti MCL1 pAb (ATL-HPA031125)

Atlas Antibodies

Catalog No.:
ATL-HPA031125-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: myeloid cell leukemia 1
Gene Name: MCL1
Alternative Gene Name: BCL2L3, Mcl-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038612: 89%, ENSRNOG00000002791: 26%
Entrez Gene ID: 4170
Uniprot ID: Q07820
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
Gene Sequence MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
Gene ID - Mouse ENSMUSG00000038612
Gene ID - Rat ENSRNOG00000002791
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MCL1 pAb (ATL-HPA031125)
Datasheet Anti MCL1 pAb (ATL-HPA031125) Datasheet (External Link)
Vendor Page Anti MCL1 pAb (ATL-HPA031125) at Atlas Antibodies

Documents & Links for Anti MCL1 pAb (ATL-HPA031125)
Datasheet Anti MCL1 pAb (ATL-HPA031125) Datasheet (External Link)
Vendor Page Anti MCL1 pAb (ATL-HPA031125)