Anti MCL1 pAb (ATL-HPA031125)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031125-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: MCL1
Alternative Gene Name: BCL2L3, Mcl-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038612: 89%, ENSRNOG00000002791: 26%
Entrez Gene ID: 4170
Uniprot ID: Q07820
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR |
Gene Sequence | MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR |
Gene ID - Mouse | ENSMUSG00000038612 |
Gene ID - Rat | ENSRNOG00000002791 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MCL1 pAb (ATL-HPA031125) | |
Datasheet | Anti MCL1 pAb (ATL-HPA031125) Datasheet (External Link) |
Vendor Page | Anti MCL1 pAb (ATL-HPA031125) at Atlas Antibodies |
Documents & Links for Anti MCL1 pAb (ATL-HPA031125) | |
Datasheet | Anti MCL1 pAb (ATL-HPA031125) Datasheet (External Link) |
Vendor Page | Anti MCL1 pAb (ATL-HPA031125) |