Anti MCCD1 pAb (ATL-HPA046948)

Atlas Antibodies

Catalog No.:
ATL-HPA046948-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mitochondrial coiled-coil domain 1
Gene Name: MCCD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040860: 33%, ENSRNOG00000008334: 32%
Entrez Gene ID: 401250
Uniprot ID: P59942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQ
Gene Sequence SQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQ
Gene ID - Mouse ENSMUSG00000040860
Gene ID - Rat ENSRNOG00000008334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MCCD1 pAb (ATL-HPA046948)
Datasheet Anti MCCD1 pAb (ATL-HPA046948) Datasheet (External Link)
Vendor Page Anti MCCD1 pAb (ATL-HPA046948) at Atlas Antibodies

Documents & Links for Anti MCCD1 pAb (ATL-HPA046948)
Datasheet Anti MCCD1 pAb (ATL-HPA046948) Datasheet (External Link)
Vendor Page Anti MCCD1 pAb (ATL-HPA046948)