Anti MCCD1 pAb (ATL-HPA046948)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046948-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $303.00
    
         
                            Gene Name: MCCD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040860: 33%, ENSRNOG00000008334: 32%
Entrez Gene ID: 401250
Uniprot ID: P59942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | SQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQ | 
| Gene Sequence | SQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQ | 
| Gene ID - Mouse | ENSMUSG00000040860 | 
| Gene ID - Rat | ENSRNOG00000008334 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti MCCD1 pAb (ATL-HPA046948) | |
| Datasheet | Anti MCCD1 pAb (ATL-HPA046948) Datasheet (External Link) | 
| Vendor Page | Anti MCCD1 pAb (ATL-HPA046948) at Atlas Antibodies | 
| Documents & Links for Anti MCCD1 pAb (ATL-HPA046948) | |
| Datasheet | Anti MCCD1 pAb (ATL-HPA046948) Datasheet (External Link) | 
| Vendor Page | Anti MCCD1 pAb (ATL-HPA046948) | 
 
         
                            