Anti MC5R pAb (ATL-HPA042365)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042365-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MC5R
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007480: 58%, ENSRNOG00000016685: 69%
Entrez Gene ID: 4161
Uniprot ID: P33032
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDM |
| Gene Sequence | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDM |
| Gene ID - Mouse | ENSMUSG00000007480 |
| Gene ID - Rat | ENSRNOG00000016685 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MC5R pAb (ATL-HPA042365) | |
| Datasheet | Anti MC5R pAb (ATL-HPA042365) Datasheet (External Link) |
| Vendor Page | Anti MC5R pAb (ATL-HPA042365) at Atlas Antibodies |
| Documents & Links for Anti MC5R pAb (ATL-HPA042365) | |
| Datasheet | Anti MC5R pAb (ATL-HPA042365) Datasheet (External Link) |
| Vendor Page | Anti MC5R pAb (ATL-HPA042365) |