Anti MC5R pAb (ATL-HPA042365)

Atlas Antibodies

Catalog No.:
ATL-HPA042365-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: melanocortin 5 receptor
Gene Name: MC5R
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007480: 58%, ENSRNOG00000016685: 69%
Entrez Gene ID: 4161
Uniprot ID: P33032
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDM
Gene Sequence MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDM
Gene ID - Mouse ENSMUSG00000007480
Gene ID - Rat ENSRNOG00000016685
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MC5R pAb (ATL-HPA042365)
Datasheet Anti MC5R pAb (ATL-HPA042365) Datasheet (External Link)
Vendor Page Anti MC5R pAb (ATL-HPA042365) at Atlas Antibodies

Documents & Links for Anti MC5R pAb (ATL-HPA042365)
Datasheet Anti MC5R pAb (ATL-HPA042365) Datasheet (External Link)
Vendor Page Anti MC5R pAb (ATL-HPA042365)