Anti MBP pAb (ATL-HPA049222)

Atlas Antibodies

Catalog No.:
ATL-HPA049222-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: myelin basic protein
Gene Name: MBP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041607: 97%, ENSRNOG00000016516: 97%
Entrez Gene ID: 4155
Uniprot ID: P02686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM
Gene Sequence DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM
Gene ID - Mouse ENSMUSG00000041607
Gene ID - Rat ENSRNOG00000016516
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MBP pAb (ATL-HPA049222)
Datasheet Anti MBP pAb (ATL-HPA049222) Datasheet (External Link)
Vendor Page Anti MBP pAb (ATL-HPA049222) at Atlas Antibodies

Documents & Links for Anti MBP pAb (ATL-HPA049222)
Datasheet Anti MBP pAb (ATL-HPA049222) Datasheet (External Link)
Vendor Page Anti MBP pAb (ATL-HPA049222)
Citations for Anti MBP pAb (ATL-HPA049222) – 2 Found
Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79.  PubMed
Gao, Yanpan; Liu, Jiaqi; Wang, Jiayu; Liu, Yifan; Zeng, Ling-Hui; Ge, Wei; Ma, Chao. Proteomic analysis of human hippocampal subfields provides new insights into the pathogenesis of Alzheimer's disease and the role of glial cells. Brain Pathology (Zurich, Switzerland). 2022;32(4):e13047.  PubMed