Anti MBIP pAb (ATL-HPA003388)

Atlas Antibodies

Catalog No.: ATL-HPA003388-25

Protein Description: MAP3K12 binding inhibitory protein 1
Gene Name: MBIP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021028: 96%, ENSRNOG00000008610: 95%
Entrez Gene ID: 51562
Uniprot ID: Q9NS73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DCNQENSCARTDAIFTPYPGFKSHVKVSRVVNTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSGKRRKVQPPQQNY
• Gene Sequence: DCNQENSCARTDAIFTPYPGFKSHVKVSRVVNTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSGKRRKVQPPQQNY
• Gene ID - Mouse: ENSMUSG00000021028
• Gene ID - Rat: ENSRNOG00000008610
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.