Anti MBD3L3 pAb (ATL-HPA051259)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051259-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MBD3L3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047508: 42%, ENSRNOG00000026629: 46%
Entrez Gene ID: 653657
Uniprot ID: A6NE82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQV |
Gene Sequence | MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQV |
Gene ID - Mouse | ENSMUSG00000047508 |
Gene ID - Rat | ENSRNOG00000026629 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MBD3L3 pAb (ATL-HPA051259) | |
Datasheet | Anti MBD3L3 pAb (ATL-HPA051259) Datasheet (External Link) |
Vendor Page | Anti MBD3L3 pAb (ATL-HPA051259) at Atlas Antibodies |
Documents & Links for Anti MBD3L3 pAb (ATL-HPA051259) | |
Datasheet | Anti MBD3L3 pAb (ATL-HPA051259) Datasheet (External Link) |
Vendor Page | Anti MBD3L3 pAb (ATL-HPA051259) |