Anti MBD3L3 pAb (ATL-HPA051259)

Atlas Antibodies

Catalog No.:
ATL-HPA051259-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: methyl-CpG binding domain protein 3 like 3
Gene Name: MBD3L3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047508: 42%, ENSRNOG00000026629: 46%
Entrez Gene ID: 653657
Uniprot ID: A6NE82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQV
Gene Sequence MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQV
Gene ID - Mouse ENSMUSG00000047508
Gene ID - Rat ENSRNOG00000026629
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MBD3L3 pAb (ATL-HPA051259)
Datasheet Anti MBD3L3 pAb (ATL-HPA051259) Datasheet (External Link)
Vendor Page Anti MBD3L3 pAb (ATL-HPA051259) at Atlas Antibodies

Documents & Links for Anti MBD3L3 pAb (ATL-HPA051259)
Datasheet Anti MBD3L3 pAb (ATL-HPA051259) Datasheet (External Link)
Vendor Page Anti MBD3L3 pAb (ATL-HPA051259)