Anti MBD2 pAb (ATL-HPA067582)

Atlas Antibodies

SKU:
ATL-HPA067582-25
  • Immunofluorescent staining of human cell line HaCaT shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: methyl-CpG binding domain protein 2
Gene Name: MBD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024513: 93%, ENSRNOG00000011853: 93%
Entrez Gene ID: 8932
Uniprot ID: Q9UBB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REPVPFPSGSAGPGPRGPRATESGKRMDCP
Gene Sequence REPVPFPSGSAGPGPRGPRATESGKRMDCP
Gene ID - Mouse ENSMUSG00000024513
Gene ID - Rat ENSRNOG00000011853
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MBD2 pAb (ATL-HPA067582)
Datasheet Anti MBD2 pAb (ATL-HPA067582) Datasheet (External Link)
Vendor Page Anti MBD2 pAb (ATL-HPA067582) at Atlas Antibodies

Documents & Links for Anti MBD2 pAb (ATL-HPA067582)
Datasheet Anti MBD2 pAb (ATL-HPA067582) Datasheet (External Link)
Vendor Page Anti MBD2 pAb (ATL-HPA067582)