Anti MBD2 pAb (ATL-HPA067582)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067582-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MBD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024513: 93%, ENSRNOG00000011853: 93%
Entrez Gene ID: 8932
Uniprot ID: Q9UBB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | REPVPFPSGSAGPGPRGPRATESGKRMDCP |
| Gene Sequence | REPVPFPSGSAGPGPRGPRATESGKRMDCP |
| Gene ID - Mouse | ENSMUSG00000024513 |
| Gene ID - Rat | ENSRNOG00000011853 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MBD2 pAb (ATL-HPA067582) | |
| Datasheet | Anti MBD2 pAb (ATL-HPA067582) Datasheet (External Link) |
| Vendor Page | Anti MBD2 pAb (ATL-HPA067582) at Atlas Antibodies |
| Documents & Links for Anti MBD2 pAb (ATL-HPA067582) | |
| Datasheet | Anti MBD2 pAb (ATL-HPA067582) Datasheet (External Link) |
| Vendor Page | Anti MBD2 pAb (ATL-HPA067582) |