Anti MASP2 pAb (ATL-HPA029313)

Atlas Antibodies

Catalog No.: ATL-HPA029313-25

Protein Description: mannan-binding lectin serine peptidase 2
Gene Name: MASP2
Alternative Gene Name: MASP1P1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028979: 78%, ENSRNOG00000011258: 78%
Entrez Gene ID: 10747
Uniprot ID: O00187
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGL
• Gene Sequence: PVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGL
• Gene ID - Mouse: ENSMUSG00000028979
• Gene ID - Rat: ENSRNOG00000011258
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MASP2 pAb (ATL-HPA029313) – 6 Found

Niederreiter, Janina; Eck, Christine; Ries, Tajana; Hartmann, Arndt; Märkl, Bruno; Büttner-Herold, Maike; Amann, Kerstin; Daniel, Christoph. Complement Activation via the Lectin and Alternative Pathway in Patients With Severe COVID-19. Frontiers In Immunology. 13( 35237273):835156. 

Magro, Cynthia; Mulvey, J Justin; Berlin, David; Nuovo, Gerard; Salvatore, Steven; Harp, Joanna; Baxter-Stoltzfus, Amelia; Laurence, Jeffrey. Complement associated microvascular injury and thrombosis in the pathogenesis of severe COVID-19 infection: A report of five cases. Translational Research : The Journal Of Laboratory And Clinical Medicine. 2020;220( 32299776):1-13. 

Laurence, Jeffrey; Mulvey, J Justin; Seshadri, Madhav; Racanelli, Alexandra; Harp, Joanna; Schenck, Edward J; Zappetti, Dana; Horn, Evelyn M; Magro, Cynthia M. Anti-complement C5 therapy with eculizumab in three cases of critical COVID-19. Clinical Immunology (Orlando, Fla.). 2020;219( 32771488):108555. 

Magro, C M; Mulvey, J J; Laurence, J; Sanders, S; Crowson, A N; Grossman, M; Harp, J; Nuovo, G. The differing pathophysiologies that underlie COVID-19-associated perniosis and thrombotic retiform purpura: a case series. The British Journal Of Dermatology. 2021;184(1):141-150. 

Pfister, Frederick; Vonbrunn, Eva; Ries, Tajana; Jäck, Hans-Martin; Überla, Klaus; Lochnit, Günter; Sheriff, Ahmed; Herrmann, Martin; Büttner-Herold, Maike; Amann, Kerstin; Daniel, Christoph. Complement Activation in Kidneys of Patients With COVID-19. Frontiers In Immunology. 11( 33584662):594849. 

Belmonte, Beatrice; Mangogna, Alessandro; Gulino, Alessandro; Cancila, Valeria; Morello, Gaia; Agostinis, Chiara; Bulla, Roberta; Ricci, Giuseppe; Fraggetta, Filippo; Botto, Marina; Garred, Peter; Tedesco, Francesco. Distinct Roles of Classical and Lectin Pathways of Complement in Preeclamptic Placentae. Frontiers In Immunology. 13( 35711467):882298.