Anti MARS pAb (ATL-HPA004125 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004125-25

Protein Description: methionyl-tRNA synthetase
Gene Name: MARS
Alternative Gene Name: MetRS, SPG70
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040354: 92%, ENSRNOG00000025459: 92%
Entrez Gene ID: 4141
Uniprot ID: P56192
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFD
• Gene Sequence: FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFD
• Gene ID - Mouse: ENSMUSG00000040354
• Gene ID - Rat: ENSRNOG00000025459
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MARS pAb (ATL-HPA004125 w/enhanced validation) – 2 Found

Botta, Elena; Theil, Arjan F; Raams, Anja; Caligiuri, Giuseppina; Giachetti, Sarah; Bione, Silvia; Accadia, Maria; Lombardi, Anita; Smith, Desiree E C; Mendes, Marisa I; Swagemakers, Sigrid M A; van der Spek, Peter J; Salomons, Gajja S; Hoeijmakers, Jan H J; Yesodharan, Dhanya; Nampoothiri, Sheela; Ogi, Tomoo; Lehmann, Alan R; Orioli, Donata; Vermeulen, Wim. Protein instability associated with AARS1 and MARS1 mutations causes trichothiodystrophy. Human Molecular Genetics. 2021;30(18):1711-1720. 

van Meel, Eline; Wegner, Daniel J; Cliften, Paul; Willing, Marcia C; White, Frances V; Kornfeld, Stuart; Cole, F Sessions. Rare recessive loss-of-function methionyl-tRNA synthetase mutations presenting as a multi-organ phenotype. Bmc Medical Genetics. 2013;14( 24103465):106.