Anti MARK1 pAb (ATL-HPA007421)

Atlas Antibodies

Catalog No.: ATL-HPA007421-25

Protein Description: MAP/microtubule affinity-regulating kinase 1
Gene Name: MARK1
Alternative Gene Name: MARK, PAR-1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026620: 95%, ENSRNOG00000002339: 92%
Entrez Gene ID: 4139
Uniprot ID: Q9P0L2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAHARRGTSTGIISKIT
• Gene Sequence: MSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAHARRGTSTGIISKIT
• Gene ID - Mouse: ENSMUSG00000026620
• Gene ID - Rat: ENSRNOG00000002339
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.