Anti MAPKAPK5 pAb (ATL-HPA015515)

Atlas Antibodies

Catalog No.: ATL-HPA015515-25

Protein Description: mitogen-activated protein kinase-activated protein kinase 5
Gene Name: MAPKAPK5
Alternative Gene Name: PRAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029454: 94%, ENSRNOG00000001345: 94%
Entrez Gene ID: 8550
Uniprot ID: Q8IW41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSH
• Gene Sequence: PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSH
• Gene ID - Mouse: ENSMUSG00000029454
• Gene ID - Rat: ENSRNOG00000001345
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAPKAPK5 pAb (ATL-HPA015515) – 3 Found

Ronkina, N; Schuster-Gossler, K; Hansmann, F; Kunze-Schumacher, H; Sandrock, I; Yakovleva, T; Lafera, J; Baumgärtner, W; Krueger, A; Prinz, I; Gossler, A; Kotlyarov, A; Gaestel, M. Germ Line Deletion Reveals a Nonessential Role of Atypical Mitogen-Activated Protein Kinase 6/Extracellular Signal-Regulated Kinase 3. Molecular And Cellular Biology. 2019;39(6) 

Vallabhaneni, Sreeram; Liu, Jian; Morel, Marion; Wang, Jixin; DeMayo, Francesco J; Long, Weiwen. Conditional ERK3 overexpression cooperates with PTEN deletion to promote lung adenocarcinoma formation in mice. Molecular Oncology. 2022;16(5):1184-1199. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.