Anti MAPK6 pAb (ATL-HPA030262)

Atlas Antibodies

Catalog No.: ATL-HPA030262-25

Protein Description: mitogen-activated protein kinase 6
Gene Name: MAPK6
Alternative Gene Name: ERK3, HsT17250, p97MAPK, PRKM6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042688: 96%, ENSRNOG00000009381: 96%
Entrez Gene ID: 5597
Uniprot ID: Q16659
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDCQFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSH
• Gene Sequence: YSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDCQFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSH
• Gene ID - Mouse: ENSMUSG00000042688
• Gene ID - Rat: ENSRNOG00000009381
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAPK6 pAb (ATL-HPA030262) – 1 Found

Jiang, Chun-Hao; Fan, Zhi-Hang; Xie, Ping; Guo, Jian-Hua. Bacillus cereus AR156 Extracellular Polysaccharides Served as a Novel Micro-associated Molecular Pattern to Induced Systemic Immunity to Pst DC3000 in Arabidopsis. Frontiers In Microbiology. 7( 27242694):664.