Anti MAPK1IP1L pAb (ATL-HPA034506)

Atlas Antibodies

Catalog No.:
ATL-HPA034506-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitogen-activated protein kinase 1 interacting protein 1-like
Gene Name: MAPK1IP1L
Alternative Gene Name: C14orf32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021840: 80%, ENSRNOG00000011611: 85%
Entrez Gene ID: 93487
Uniprot ID: Q8NDC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGG
Gene Sequence APPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGG
Gene ID - Mouse ENSMUSG00000021840
Gene ID - Rat ENSRNOG00000011611
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAPK1IP1L pAb (ATL-HPA034506)
Datasheet Anti MAPK1IP1L pAb (ATL-HPA034506) Datasheet (External Link)
Vendor Page Anti MAPK1IP1L pAb (ATL-HPA034506) at Atlas Antibodies

Documents & Links for Anti MAPK1IP1L pAb (ATL-HPA034506)
Datasheet Anti MAPK1IP1L pAb (ATL-HPA034506) Datasheet (External Link)
Vendor Page Anti MAPK1IP1L pAb (ATL-HPA034506)
Citations for Anti MAPK1IP1L pAb (ATL-HPA034506) – 2 Found
Takahara, Terunao; Inoue, Kuniko; Arai, Yumika; Kuwata, Keiko; Shibata, Hideki; Maki, Masatoshi. The calcium-binding protein ALG-2 regulates protein secretion and trafficking via interactions with MISSL and MAP1B proteins. The Journal Of Biological Chemistry. 2017;292(41):17057-17072.  PubMed
Inukai, Ryuta; Mori, Kanako; Kuwata, Keiko; Suzuki, Chihiro; Maki, Masatoshi; Takahara, Terunao; Shibata, Hideki. The Novel ALG-2 Target Protein CDIP1 Promotes Cell Death by Interacting with ESCRT-I and VAPA/B. International Journal Of Molecular Sciences. 2021;22(3)  PubMed