Anti MAP2 pAb (ATL-HPA012828 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA012828-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: microtubule-associated protein 2
Gene Name: MAP2
Alternative Gene Name: MAP2A, MAP2B, MAP2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015222: 91%, ENSRNOG00000011841: 90%
Entrez Gene ID: 4133
Uniprot ID: P11137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT
Gene Sequence EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT
Gene ID - Mouse ENSMUSG00000015222
Gene ID - Rat ENSRNOG00000011841
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAP2 pAb (ATL-HPA012828 w/enhanced validation)
Datasheet Anti MAP2 pAb (ATL-HPA012828 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAP2 pAb (ATL-HPA012828 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MAP2 pAb (ATL-HPA012828 w/enhanced validation)
Datasheet Anti MAP2 pAb (ATL-HPA012828 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAP2 pAb (ATL-HPA012828 w/enhanced validation)
Citations for Anti MAP2 pAb (ATL-HPA012828 w/enhanced validation) – 5 Found
Liu, Mei; Qin, Lixia; Wang, Lili; Tan, Jieqiong; Zhang, Hainan; Tang, Jianguang; Shen, Xiangmin; Tan, Liming; Wang, Chunyu. α‑synuclein induces apoptosis of astrocytes by causing dysfunction of the endoplasmic reticulum‑Golgi compartment. Molecular Medicine Reports. 2018;18(1):322-332.  PubMed
Pontén, F; Jirström, K; Uhlen, M. The Human Protein Atlas--a tool for pathology. The Journal Of Pathology. 2008;216(4):387-93.  PubMed
Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84.  PubMed
Petkov, Stoyan; Dressel, Ralf; Rodriguez-Polo, Ignacio; Behr, Rüdiger. Controlling the Switch from Neurogenesis to Pluripotency during Marmoset Monkey Somatic Cell Reprogramming with Self-Replicating mRNAs and Small Molecules. Cells. 2020;9(11)  PubMed
Cai, Chengyun; Wang, Lifeng; Li, Shixin; Lou, Shengchun; Luo, Jia-Lie; Fu, Ding-Yi; Chen, Tingting. Ras Inhibitor Lonafarnib Rescues Structural and Functional Impairments of Synapses of Aβ(1-42) Mice via α7nAChR-Dependent BDNF Upregulation. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2022;42(31):6090-6107.  PubMed