Anti MAP1B pAb (ATL-HPA022275 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022275-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MAP1B
Alternative Gene Name: MAP5, PPP1R102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052727: 85%, ENSRNOG00000017428: 86%
Entrez Gene ID: 4131
Uniprot ID: P46821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST |
| Gene Sequence | EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST |
| Gene ID - Mouse | ENSMUSG00000052727 |
| Gene ID - Rat | ENSRNOG00000017428 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAP1B pAb (ATL-HPA022275 w/enhanced validation) | |
| Datasheet | Anti MAP1B pAb (ATL-HPA022275 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MAP1B pAb (ATL-HPA022275 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MAP1B pAb (ATL-HPA022275 w/enhanced validation) | |
| Datasheet | Anti MAP1B pAb (ATL-HPA022275 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MAP1B pAb (ATL-HPA022275 w/enhanced validation) |
| Citations for Anti MAP1B pAb (ATL-HPA022275 w/enhanced validation) – 4 Found |
| Danielsson, Frida; Wiking, Mikaela; Mahdessian, Diana; Skogs, Marie; Ait Blal, Hammou; Hjelmare, Martin; Stadler, Charlotte; Uhlén, Mathias; Lundberg, Emma. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. Journal Of Proteome Research. 2013;12(1):299-307. PubMed |
| Wu, Yuan; Zheng, Xiudan; Ding, Yubo; Zhou, Min; Wei, Zhuang; Liu, Tao; Liao, Kan. The molecular chaperone Hsp90α deficiency causes retinal degeneration by disrupting Golgi organization and vesicle transportation in photoreceptors. Journal Of Molecular Cell Biology. 2020;12(3):216-229. PubMed |
| Wu, Yuan; Ding, Yubo; Zheng, Xiudan; Liao, Kan. The molecular chaperone Hsp90 maintains Golgi organization and vesicular trafficking by regulating microtubule stability. Journal Of Molecular Cell Biology. 2020;12(6):448-461. PubMed |
| Strohm, Laura; Hu, Zehan; Suk, Yongwon; Rühmkorf, Alina; Sternburg, Erin; Gattringer, Vanessa; Riemenschneider, Henrick; Berutti, Riccardo; Graf, Elisabeth; Weishaupt, Jochen H; Brill, Monika S; Harbauer, Angelika B; Dormann, Dorothee; Dengjel, Jörn; Edbauer, Dieter; Behrends, Christian. Multi-omics profiling identifies a deregulated FUS-MAP1B axis in ALS/FTD-associated UBQLN2 mutants. Life Science Alliance. 2022;5(11) PubMed |