Anti MAP1B pAb (ATL-HPA022275 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022275-25

Protein Description: microtubule-associated protein 1B
Gene Name: MAP1B
Alternative Gene Name: MAP5, PPP1R102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052727: 85%, ENSRNOG00000017428: 86%
Entrez Gene ID: 4131
Uniprot ID: P46821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST
• Gene Sequence: EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST
• Gene ID - Mouse: ENSMUSG00000052727
• Gene ID - Rat: ENSRNOG00000017428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAP1B pAb (ATL-HPA022275 w/enhanced validation) – 4 Found

Danielsson, Frida; Wiking, Mikaela; Mahdessian, Diana; Skogs, Marie; Ait Blal, Hammou; Hjelmare, Martin; Stadler, Charlotte; Uhlén, Mathias; Lundberg, Emma. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. Journal Of Proteome Research. 2013;12(1):299-307. 

Wu, Yuan; Zheng, Xiudan; Ding, Yubo; Zhou, Min; Wei, Zhuang; Liu, Tao; Liao, Kan. The molecular chaperone Hsp90α deficiency causes retinal degeneration by disrupting Golgi organization and vesicle transportation in photoreceptors. Journal Of Molecular Cell Biology. 2020;12(3):216-229. 

Wu, Yuan; Ding, Yubo; Zheng, Xiudan; Liao, Kan. The molecular chaperone Hsp90 maintains Golgi organization and vesicular trafficking by regulating microtubule stability. Journal Of Molecular Cell Biology. 2020;12(6):448-461. 

Strohm, Laura; Hu, Zehan; Suk, Yongwon; Rühmkorf, Alina; Sternburg, Erin; Gattringer, Vanessa; Riemenschneider, Henrick; Berutti, Riccardo; Graf, Elisabeth; Weishaupt, Jochen H; Brill, Monika S; Harbauer, Angelika B; Dormann, Dorothee; Dengjel, Jörn; Edbauer, Dieter; Behrends, Christian. Multi-omics profiling identifies a deregulated FUS-MAP1B axis in ALS/FTD-associated UBQLN2 mutants. Life Science Alliance. 2022;5(11)