Anti MAMDC2 pAb (ATL-HPA021814 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021814-25

Protein Description: MAM domain containing 2
Gene Name: MAMDC2
Alternative Gene Name: MGC21981
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033207: 93%, ENSRNOG00000024620: 93%
Entrez Gene ID: 256691
Uniprot ID: Q7Z304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IFEENHVVQEKIWSVLESPRGVWMQAEITFKKPMPTKVVFMSLCKSFWDCGLVALDDITIQLGSCSSSEKLPPPPGECTFEQDECTFTQEKRNRSSWHRRRGETPTSYTGPKGDHTTGVGYYMYIEASHM
• Gene Sequence: IFEENHVVQEKIWSVLESPRGVWMQAEITFKKPMPTKVVFMSLCKSFWDCGLVALDDITIQLGSCSSSEKLPPPPGECTFEQDECTFTQEKRNRSSWHRRRGETPTSYTGPKGDHTTGVGYYMYIEASHM
• Gene ID - Mouse: ENSMUSG00000033207
• Gene ID - Rat: ENSRNOG00000024620
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAMDC2 pAb (ATL-HPA021814 w/enhanced validation) – 2 Found

Wierer, Michael; Prestel, Matthias; Schiller, Herbert B; Yan, Guangyao; Schaab, Christoph; Azghandi, Sepiede; Werner, Julia; Kessler, Thorsten; Malik, Rainer; Murgia, Marta; Aherrahrou, Zouhair; Schunkert, Heribert; Dichgans, Martin; Mann, Matthias. Compartment-resolved Proteomic Analysis of Mouse Aorta during Atherosclerotic Plaque Formation Reveals Osteoclast-specific Protein Expression. Molecular & Cellular Proteomics : Mcp. 2018;17(2):321-334. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.