Anti MALSU1 pAb (ATL-HPA020487)

Atlas Antibodies

Catalog No.: ATL-HPA020487-25

Protein Description: mitochondrial assembly of ribosomal large subunit 1
Gene Name: MALSU1
Alternative Gene Name: C7orf30, mtRsfA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029815: 86%, ENSRNOG00000009035: 85%
Entrez Gene ID: 115416
Uniprot ID: Q96EH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPV
• Gene Sequence: AFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPV
• Gene ID - Mouse: ENSMUSG00000029815
• Gene ID - Rat: ENSRNOG00000009035
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MALSU1 pAb (ATL-HPA020487) – 1 Found

Reyes, Aurelio; Favia, Paola; Vidoni, Sara; Petruzzella, Vittoria; Zeviani, Massimo. RCC1L (WBSCR16) isoforms coordinate mitochondrial ribosome assembly through their interaction with GTPases. Plos Genetics. 2020;16(7):e1008923.