Anti MAGOH pAb (ATL-HPA043036)

Atlas Antibodies

Catalog No.:
ATL-HPA043036-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: mago homolog, exon junction complex core component
Gene Name: MAGOH
Alternative Gene Name: MAGOH1, MAGOHA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030188: 100%, ENSRNOG00000010316: 100%
Entrez Gene ID: 4116
Uniprot ID: P61326
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHIS
Gene Sequence KLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHIS
Gene ID - Mouse ENSMUSG00000030188
Gene ID - Rat ENSRNOG00000010316
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAGOH pAb (ATL-HPA043036)
Datasheet Anti MAGOH pAb (ATL-HPA043036) Datasheet (External Link)
Vendor Page Anti MAGOH pAb (ATL-HPA043036) at Atlas Antibodies

Documents & Links for Anti MAGOH pAb (ATL-HPA043036)
Datasheet Anti MAGOH pAb (ATL-HPA043036) Datasheet (External Link)
Vendor Page Anti MAGOH pAb (ATL-HPA043036)