Anti MAGI2 pAb (ATL-HPA013650)

Atlas Antibodies

Catalog No.: ATL-HPA013650-25

Protein Description: membrane associated guanylate kinase, WW and PDZ domain containing 2
Gene Name: MAGI2
Alternative Gene Name: ACVRIP1, AIP1, ARIP1, KIAA0705, MAGI-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040003: 93%, ENSRNOG00000013962: 92%
Entrez Gene ID: 9863
Uniprot ID: Q86UL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEMA
• Gene Sequence: AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEMA
• Gene ID - Mouse: ENSMUSG00000040003
• Gene ID - Rat: ENSRNOG00000013962
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAGI2 pAb (ATL-HPA013650) – 1 Found

Bierzynska, Agnieszka; Soderquest, Katrina; Dean, Philip; Colby, Elizabeth; Rollason, Ruth; Jones, Caroline; Inward, Carol D; McCarthy, Hugh J; Simpson, Michael A; Lord, Graham M; Williams, Maggie; Welsh, Gavin I; Koziell, Ania B; Saleem, Moin A. MAGI2 Mutations Cause Congenital Nephrotic Syndrome. Journal Of The American Society Of Nephrology : Jasn. 2017;28(5):1614-1621.