Anti MAFB pAb (ATL-HPA005653)

Atlas Antibodies

Catalog No.: ATL-HPA005653-25

Protein Description: v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B
Gene Name: MAFB
Alternative Gene Name: KRML
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074622: 98%, ENSRNOG00000016037: 98%
Entrez Gene ID: 9935
Uniprot ID: Q9Y5Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH
• Gene Sequence: MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH
• Gene ID - Mouse: ENSMUSG00000074622
• Gene ID - Rat: ENSRNOG00000016037
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAFB pAb (ATL-HPA005653) – 15 Found

Brunskill, Eric W; Park, Joo-Seop; Chung, Eunah; Chen, Feng; Magella, Bliss; Potter, S Steven. Single cell dissection of early kidney development: multilineage priming. Development (Cambridge, England). 2014;141(15):3093-101. 

Nishimura, Koji; Noda, Teppei; Dabdoub, Alain. Dynamic Expression of Sox2, Gata3, and Prox1 during Primary Auditory Neuron Development in the Mammalian Cochlea. Plos One. 12(1):e0170568. 

Sweeney, Lora B; Bikoff, Jay B; Gabitto, Mariano I; Brenner-Morton, Susan; Baek, Myungin; Yang, Jerry H; Tabak, Esteban G; Dasen, Jeremy S; Kintner, Christopher R; Jessell, Thomas M. Origin and Segmental Diversity of Spinal Inhibitory Interneurons. Neuron. 2018;97(2):341-355.e3. 

Pai, Emily Ling-Lin; Vogt, Daniel; Clemente-Perez, Alexandra; McKinsey, Gabriel L; Cho, Frances S; Hu, Jia Sheng; Wimer, Matt; Paul, Anirban; Fazel Darbandi, Siavash; Pla, Ramon; Nowakowski, Tomasz J; Goodrich, Lisa V; Paz, Jeanne T; Rubenstein, John L R. Mafb and c-Maf Have Prenatal Compensatory and Postnatal Antagonistic Roles in Cortical Interneuron Fate and Function. Cell Reports. 2019;26(5):1157-1173.e5. 

Morante-Palacios, Octavio; Ciudad, Laura; Micheroli, Raphael; de la Calle-Fabregat, Carlos; Li, Tianlu; Barbisan, Gisela; Houtman, Miranda; Edalat, Sam G; Frank-Bertoncelj, Mojca; Ospelt, Caroline; Ballestar, Esteban. Coordinated glucocorticoid receptor and MAFB action induces tolerogenesis and epigenome remodeling in dendritic cells. Nucleic Acids Research. 2022;50(1):108-126. 

Tian, Yang; Liu, Binbing; Li, Yuchen; Zhang, Yongzhi; Shao, Jiang; Wu, Pei; Xu, Chao; Chen, Guangduo; Shi, Huaizhang. Activation of RARα Receptor Attenuates Neuroinflammation After SAH via Promoting M1-to-M2 Phenotypic Polarization of Microglia and Regulating Mafb/Msr1/PI3K-Akt/NF-κB Pathway. Frontiers In Immunology. 13( 35237277):839796. 

González de la Aleja, Arturo; Herrero, Cristina; Torres-Torresano, Mónica; de la Rosa, Juan Vladimir; Alonso, Bárbara; Capa-Sardón, Enrique; Muller, Ittai B; Jansen, Gerrit; Puig-Kröger, Amaya; Vega, Miguel A; Castrillo, Antonio; Corbí, Ángel L. Activation of LXR Nuclear Receptors Impairs the Anti-Inflammatory Gene and Functional Profile of M-CSF-Dependent Human Monocyte-Derived Macrophages. Frontiers In Immunology. 13( 35280993):835478. 

Hosoya, Makoto; Fujioka, Masato; Okahara, Junko; Yoshimatsu, Sho; Okano, Hideyuki; Ozawa, Hiroyuki. Early development of the cochlea of the common marmoset, a non-human primate model. Neural Development. 2022;17(1):6. 

Pasquali, Lorenzo; Gaulton, Kyle J; Rodríguez-Seguí, Santiago A; Mularoni, Loris; Miguel-Escalada, Irene; Akerman, İldem; Tena, Juan J; Morán, Ignasi; Gómez-Marín, Carlos; van de Bunt, Martijn; Ponsa-Cobas, Joan; Castro, Natalia; Nammo, Takao; Cebola, Inês; García-Hurtado, Javier; Maestro, Miguel Angel; Pattou, François; Piemonti, Lorenzo; Berney, Thierry; Gloyn, Anna L; Ravassard, Philippe; Skarmeta, José Luis Gómez; Müller, Ferenc; McCarthy, Mark I; Ferrer, Jorge. Pancreatic islet enhancer clusters enriched in type 2 diabetes risk-associated variants. Nature Genetics. 2014;46(2):136-143. 

Johnson Chacko, Lejo; Pechriggl, Elisabeth J; Fritsch, Helga; Rask-Andersen, Helge; Blumer, Michael J F; Schrott-Fischer, Anneliese; Glueckert, Rudolf. Neurosensory Differentiation and Innervation Patterning in the Human Fetal Vestibular End Organs between the Gestational Weeks 8-12. Frontiers In Neuroanatomy. 10( 27895556):111. 

Deacon, Patrick; Concodora, Charles W; Chung, Eunah; Park, Joo-Seop. β-catenin regulates the formation of multiple nephron segments in the mouse kidney. Scientific Reports. 2019;9(1):15915. 

Li, Chao; Li, Xiang; Bi, Zhenghong; Sugino, Ken; Wang, Guangqin; Zhu, Tong; Liu, Zhiyong. Comprehensive transcriptome analysis of cochlear spiral ganglion neurons at multiple ages. Elife. 2020;9( 31913118) 

Hogrebe, Nathaniel J; Augsornworawat, Punn; Maxwell, Kristina G; Velazco-Cruz, Leonardo; Millman, Jeffrey R. Targeting the cytoskeleton to direct pancreatic differentiation of human pluripotent stem cells. Nature Biotechnology. 2020;38(4):460-470. 

Dieterich, Lothar C; Tacconi, Carlotta; Menzi, Franziska; Proulx, Steven T; Kapaklikaya, Kübra; Hamada, Michito; Takahashi, Satoru; Detmar, Michael. Lymphatic MAFB regulates vascular patterning during developmental and pathological lymphangiogenesis. Angiogenesis. 2020;23(3):411-423. 

Ito, Ayako; Imamura, Fumiaki. Expression of Maf family proteins in glutamatergic neurons of the mouse olfactory bulb. Developmental Neurobiology. 2022;82(1):77-87.