Anti MAD2L1BP pAb (ATL-HPA028729)

Atlas Antibodies

Catalog No.: ATL-HPA028729-25

Protein Description: MAD2L1 binding protein
Gene Name: MAD2L1BP
Alternative Gene Name: CMT2, dJ261G23.1, KIAA0110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034509: 72%, ENSRNOG00000019463: 73%
Entrez Gene ID: 9587
Uniprot ID: Q15013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCCQFTCELLKHIMYQRQQLPLPY
• Gene Sequence: PDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCCQFTCELLKHIMYQRQQLPLPY
• Gene ID - Mouse: ENSMUSG00000034509
• Gene ID - Rat: ENSRNOG00000019463
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.