Anti MACC1 pAb (ATL-HPA020103)

Atlas Antibodies

Catalog No.: ATL-HPA020103-25

Protein Description: metastasis associated in colon cancer 1
Gene Name: MACC1
Alternative Gene Name: 7A5, SH3BP4L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041886: 57%, ENSRNOG00000037436: 58%
Entrez Gene ID: 346389
Uniprot ID: Q6ZN28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF
• Gene Sequence: FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF
• Gene ID - Mouse: ENSMUSG00000041886
• Gene ID - Rat: ENSRNOG00000037436
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MACC1 pAb (ATL-HPA020103) – 7 Found

Ashktorab, Hassan; Hermann, Pia; Nouraie, Mehdi; Shokrani, Babak; Lee, Edward; Haidary, Tahmineh; Brim, Hassan; Stein, Ulrike. Increased MACC1 levels in tissues and blood identify colon adenoma patients at high risk. Journal Of Translational Medicine. 2016;14(1):215. 

Ilm, Katharina; Fuchs, Steffen; Mudduluru, Giridhar; Stein, Ulrike. MACC1 is post-transcriptionally regulated by miR-218 in colorectal cancer. Oncotarget. 2016;7(33):53443-53458. 

Treese, Christoph; Werchan, Jessica; von Winterfeld, Moritz; Berg, Erika; Hummel, Michael; Timm, Lena; Rau, Beate; Daberkow, Ole; Walther, Wolfgang; Daum, Severin; Kobelt, Dennis; Stein, Ulrike. Inhibition of MACC1-Induced Metastasis in Esophageal and Gastric Adenocarcinomas. Cancers. 2022;14(7) 

Ge, Yunfei; Meng, Xiangrui; Zhou, Yong; Zhang, Jianliang; Ding, Yinlu. Positive MACC1 expression correlates with invasive behaviors and postoperative liver metastasis in colon cancer. International Journal Of Clinical And Experimental Medicine. 8(1):1094-100. 

Koelzer, Viktor H; Herrmann, Pia; Zlobec, Inti; Karamitopoulou, Eva; Lugli, Alessandro; Stein, Ulrike. Heterogeneity analysis of Metastasis Associated in Colon Cancer 1 (MACC1) for survival prognosis of colorectal cancer patients: a retrospective cohort study. Bmc Cancer. 2015;15( 25884643):160. 

Kobelt, Dennis; Zhang, Chenyu; Clayton-Lucey, Isabelle Ailish; Glauben, Rainer; Voss, Cynthia; Siegmund, Britta; Stein, Ulrike. Pro-inflammatory TNF-α and IFN-γ Promote Tumor Growth and Metastasis via Induction of MACC1. Frontiers In Immunology. 11( 32670264):980. 

Imbastari, Francesca; Dahlmann, Mathias; Sporbert, Anje; Mattioli, Camilla Ciolli; Mari, Tommaso; Scholz, Florian; Timm, Lena; Twamley, Shailey; Migotti, Rebekka; Walther, Wolfgang; Dittmar, Gunnar; Rehm, Armin; Stein, Ulrike. MACC1 regulates clathrin-mediated endocytosis and receptor recycling of transferrin receptor and EGFR in colorectal cancer. Cellular And Molecular Life Sciences : Cmls. 2021;78(7):3525-3542.