Anti MAB21L3 pAb (ATL-HPA039551)

Atlas Antibodies

Catalog No.:
ATL-HPA039551-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mab-21-like 3 (C. elegans)
Gene Name: MAB21L3
Alternative Gene Name: C1orf161, FLJ38716
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044313: 81%, ENSRNOG00000016044: 80%
Entrez Gene ID: 126868
Uniprot ID: Q8N8X9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TWSKKARWPRCLQRWPSQERVECIKSFGFNLLACSNYHWQLSFLRAEQVLLEQLDEDGGCRRKCFQVMRHLKEDIWCPGNRPV
Gene Sequence TWSKKARWPRCLQRWPSQERVECIKSFGFNLLACSNYHWQLSFLRAEQVLLEQLDEDGGCRRKCFQVMRHLKEDIWCPGNRPV
Gene ID - Mouse ENSMUSG00000044313
Gene ID - Rat ENSRNOG00000016044
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAB21L3 pAb (ATL-HPA039551)
Datasheet Anti MAB21L3 pAb (ATL-HPA039551) Datasheet (External Link)
Vendor Page Anti MAB21L3 pAb (ATL-HPA039551) at Atlas Antibodies

Documents & Links for Anti MAB21L3 pAb (ATL-HPA039551)
Datasheet Anti MAB21L3 pAb (ATL-HPA039551) Datasheet (External Link)
Vendor Page Anti MAB21L3 pAb (ATL-HPA039551)