Anti MAB21L3 pAb (ATL-HPA039551)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039551-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MAB21L3
Alternative Gene Name: C1orf161, FLJ38716
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044313: 81%, ENSRNOG00000016044: 80%
Entrez Gene ID: 126868
Uniprot ID: Q8N8X9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TWSKKARWPRCLQRWPSQERVECIKSFGFNLLACSNYHWQLSFLRAEQVLLEQLDEDGGCRRKCFQVMRHLKEDIWCPGNRPV |
| Gene Sequence | TWSKKARWPRCLQRWPSQERVECIKSFGFNLLACSNYHWQLSFLRAEQVLLEQLDEDGGCRRKCFQVMRHLKEDIWCPGNRPV |
| Gene ID - Mouse | ENSMUSG00000044313 |
| Gene ID - Rat | ENSRNOG00000016044 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAB21L3 pAb (ATL-HPA039551) | |
| Datasheet | Anti MAB21L3 pAb (ATL-HPA039551) Datasheet (External Link) |
| Vendor Page | Anti MAB21L3 pAb (ATL-HPA039551) at Atlas Antibodies |
| Documents & Links for Anti MAB21L3 pAb (ATL-HPA039551) | |
| Datasheet | Anti MAB21L3 pAb (ATL-HPA039551) Datasheet (External Link) |
| Vendor Page | Anti MAB21L3 pAb (ATL-HPA039551) |