Anti LY6K pAb (ATL-HPA017770 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017770-25

Protein Description: lymphocyte antigen 6 complex, locus K
Gene Name: LY6K
Alternative Gene Name: CT97, FLJ35226, HSJ001348
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044678: 41%, ENSRNOG00000025725: 39%
Entrez Gene ID: 54742
Uniprot ID: Q17RY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG
• Gene Sequence: TDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG
• Gene ID - Mouse: ENSMUSG00000044678
• Gene ID - Rat: ENSRNOG00000025725
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LY6K pAb (ATL-HPA017770 w/enhanced validation) – 4 Found

Ambatipudi, Srikant; Gerstung, Moritz; Pandey, Manishkumar; Samant, Tanuja; Patil, Asawari; Kane, Shubhada; Desai, Rajiv S; Schäffer, Alejandro A; Beerenwinkel, Niko; Mahimkar, Manoj B. Genome-wide expression and copy number analysis identifies driver genes in gingivobuccal cancers. Genes, Chromosomes & Cancer. 2012;51(2):161-73. 

Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614. 

Carrero, Ivenise; Liu, Hsuan-Chen; Sikora, Andrew G; Milosavljevic, Aleksandar. Histoepigenetic analysis of HPV- and tobacco-associated head and neck cancer identifies both subtype-specific and common therapeutic targets despite divergent microenvironments. Oncogene. 2019;38(19):3551-3568. 

Benti, Senyi; Tiwari, Purushottam B; Goodlett, Dustin W; Daneshian, Leily; Kern, Grant B; Smith, Mark D; Uren, Aykut; Chruszcz, Maksymilian; Shimizu, Linda S; Upadhyay, Geeta. Small Molecule Binds with Lymphocyte Antigen 6K to Induce Cancer Cell Death. Cancers. 2020;12(2)