Anti LTB pAb (ATL-HPA048884)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048884-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LTB
Alternative Gene Name: p33, TNFC, TNFSF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024399: 53%, ENSRNOG00000058566: 53%
Entrez Gene ID: 4050
Uniprot ID: Q06643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSD |
Gene Sequence | GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSD |
Gene ID - Mouse | ENSMUSG00000024399 |
Gene ID - Rat | ENSRNOG00000058566 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LTB pAb (ATL-HPA048884) | |
Datasheet | Anti LTB pAb (ATL-HPA048884) Datasheet (External Link) |
Vendor Page | Anti LTB pAb (ATL-HPA048884) at Atlas Antibodies |
Documents & Links for Anti LTB pAb (ATL-HPA048884) | |
Datasheet | Anti LTB pAb (ATL-HPA048884) Datasheet (External Link) |
Vendor Page | Anti LTB pAb (ATL-HPA048884) |
Citations for Anti LTB pAb (ATL-HPA048884) – 1 Found |
Cox, Sharon Natasha; Chiurlia, Samantha; Divella, Chiara; Rossini, Michele; Serino, Grazia; Bonomini, Mario; Sirolli, Vittorio; Aiello, Francesca B; Zaza, Gianluigi; Squarzoni, Isabella; Gangemi, Concetta; Stangou, Maria; Papagianni, Aikaterini; Haas, Mark; Schena, Francesco Paolo. Formalin-fixed paraffin-embedded renal biopsy tissues: an underexploited biospecimen resource for gene expression profiling in IgA nephropathy. Scientific Reports. 2020;10(1):15164. PubMed |