Anti LRRN3 pAb (ATL-HPA046792)

Atlas Antibodies

Catalog No.: ATL-HPA046792-25

Protein Description: leucine rich repeat neuronal 3
Gene Name: LRRN3
Alternative Gene Name: FIGLER5, FLJ11129, NLRR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036295: 90%, ENSRNOG00000006368: 90%
Entrez Gene ID: 54674
Uniprot ID: Q9H3W5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELSNL
• Gene Sequence: QNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELSNL
• Gene ID - Mouse: ENSMUSG00000036295
• Gene ID - Rat: ENSRNOG00000006368
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.