Anti LRRN3 pAb (ATL-HPA046792)

Atlas Antibodies

Catalog No.:
ATL-HPA046792-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat neuronal 3
Gene Name: LRRN3
Alternative Gene Name: FIGLER5, FLJ11129, NLRR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036295: 90%, ENSRNOG00000006368: 90%
Entrez Gene ID: 54674
Uniprot ID: Q9H3W5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELSNL
Gene Sequence QNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELSNL
Gene ID - Mouse ENSMUSG00000036295
Gene ID - Rat ENSRNOG00000006368
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRN3 pAb (ATL-HPA046792)
Datasheet Anti LRRN3 pAb (ATL-HPA046792) Datasheet (External Link)
Vendor Page Anti LRRN3 pAb (ATL-HPA046792) at Atlas Antibodies

Documents & Links for Anti LRRN3 pAb (ATL-HPA046792)
Datasheet Anti LRRN3 pAb (ATL-HPA046792) Datasheet (External Link)
Vendor Page Anti LRRN3 pAb (ATL-HPA046792)