Anti LRRN3 pAb (ATL-HPA046792)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046792-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LRRN3
Alternative Gene Name: FIGLER5, FLJ11129, NLRR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036295: 90%, ENSRNOG00000006368: 90%
Entrez Gene ID: 54674
Uniprot ID: Q9H3W5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELSNL |
Gene Sequence | QNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELSNL |
Gene ID - Mouse | ENSMUSG00000036295 |
Gene ID - Rat | ENSRNOG00000006368 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LRRN3 pAb (ATL-HPA046792) | |
Datasheet | Anti LRRN3 pAb (ATL-HPA046792) Datasheet (External Link) |
Vendor Page | Anti LRRN3 pAb (ATL-HPA046792) at Atlas Antibodies |
Documents & Links for Anti LRRN3 pAb (ATL-HPA046792) | |
Datasheet | Anti LRRN3 pAb (ATL-HPA046792) Datasheet (External Link) |
Vendor Page | Anti LRRN3 pAb (ATL-HPA046792) |