Anti LRRIQ1 pAb (ATL-HPA046162)

Atlas Antibodies

SKU: ATL-HPA046162-25

• 

Protein Description: leucine-rich repeats and IQ motif containing 1
Gene Name: LRRIQ1
Alternative Gene Name: FLJ12303, KIAA1801
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019892: 58%, ENSRNOG00000004564: 63%
Entrez Gene ID: 84125
Uniprot ID: Q96JM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQTLKAQRDREEKQFQEEEEKR
• Gene Sequence: ATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQTLKAQRDREEKQFQEEEEKR
• Gene ID - Mouse: ENSMUSG00000019892
• Gene ID - Rat: ENSRNOG00000004564
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.