Anti LRRC41 pAb (ATL-HPA051941)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051941-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LRRC41
Alternative Gene Name: MUF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028703: 97%, ENSRNOG00000013642: 96%
Entrez Gene ID: 10489
Uniprot ID: Q15345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRF |
Gene Sequence | KPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRF |
Gene ID - Mouse | ENSMUSG00000028703 |
Gene ID - Rat | ENSRNOG00000013642 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LRRC41 pAb (ATL-HPA051941) | |
Datasheet | Anti LRRC41 pAb (ATL-HPA051941) Datasheet (External Link) |
Vendor Page | Anti LRRC41 pAb (ATL-HPA051941) at Atlas Antibodies |
Documents & Links for Anti LRRC41 pAb (ATL-HPA051941) | |
Datasheet | Anti LRRC41 pAb (ATL-HPA051941) Datasheet (External Link) |
Vendor Page | Anti LRRC41 pAb (ATL-HPA051941) |
Citations for Anti LRRC41 pAb (ATL-HPA051941) – 1 Found |
Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094. PubMed |