Anti LRRC41 pAb (ATL-HPA051941)

Atlas Antibodies

Catalog No.:
ATL-HPA051941-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 41
Gene Name: LRRC41
Alternative Gene Name: MUF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028703: 97%, ENSRNOG00000013642: 96%
Entrez Gene ID: 10489
Uniprot ID: Q15345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRF
Gene Sequence KPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRF
Gene ID - Mouse ENSMUSG00000028703
Gene ID - Rat ENSRNOG00000013642
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC41 pAb (ATL-HPA051941)
Datasheet Anti LRRC41 pAb (ATL-HPA051941) Datasheet (External Link)
Vendor Page Anti LRRC41 pAb (ATL-HPA051941) at Atlas Antibodies

Documents & Links for Anti LRRC41 pAb (ATL-HPA051941)
Datasheet Anti LRRC41 pAb (ATL-HPA051941) Datasheet (External Link)
Vendor Page Anti LRRC41 pAb (ATL-HPA051941)
Citations for Anti LRRC41 pAb (ATL-HPA051941) – 1 Found
Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094.  PubMed