Anti LRRC15 pAb (ATL-HPA035503)

Atlas Antibodies

Catalog No.:
ATL-HPA035503-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 15
Gene Name: LRRC15
Alternative Gene Name: LIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052316: 65%, ENSRNOG00000038539: 73%
Entrez Gene ID: 131578
Uniprot ID: Q8TF66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVPSVHVPEVPSYPETPWYPDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVW
Gene Sequence NWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVPSVHVPEVPSYPETPWYPDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVW
Gene ID - Mouse ENSMUSG00000052316
Gene ID - Rat ENSRNOG00000038539
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC15 pAb (ATL-HPA035503)
Datasheet Anti LRRC15 pAb (ATL-HPA035503) Datasheet (External Link)
Vendor Page Anti LRRC15 pAb (ATL-HPA035503) at Atlas Antibodies

Documents & Links for Anti LRRC15 pAb (ATL-HPA035503)
Datasheet Anti LRRC15 pAb (ATL-HPA035503) Datasheet (External Link)
Vendor Page Anti LRRC15 pAb (ATL-HPA035503)