Anti LRRC15 pAb (ATL-HPA035503)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035503-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: LRRC15
Alternative Gene Name: LIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052316: 65%, ENSRNOG00000038539: 73%
Entrez Gene ID: 131578
Uniprot ID: Q8TF66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVPSVHVPEVPSYPETPWYPDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVW |
| Gene Sequence | NWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVPSVHVPEVPSYPETPWYPDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVW |
| Gene ID - Mouse | ENSMUSG00000052316 |
| Gene ID - Rat | ENSRNOG00000038539 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRRC15 pAb (ATL-HPA035503) | |
| Datasheet | Anti LRRC15 pAb (ATL-HPA035503) Datasheet (External Link) |
| Vendor Page | Anti LRRC15 pAb (ATL-HPA035503) at Atlas Antibodies |
| Documents & Links for Anti LRRC15 pAb (ATL-HPA035503) | |
| Datasheet | Anti LRRC15 pAb (ATL-HPA035503) Datasheet (External Link) |
| Vendor Page | Anti LRRC15 pAb (ATL-HPA035503) |