Anti LRRC10B pAb (ATL-HPA047619)

Atlas Antibodies

SKU:
ATL-HPA047619-25
  • Immunohistochemical staining of human prostate shows strong positivity with a granular pattern.
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 10B
Gene Name: LRRC10B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090291: 99%, ENSRNOG00000030180: 99%
Entrez Gene ID: 390205
Uniprot ID: A6NIK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFAQLQSLRCLWIEGNFLRRF
Gene Sequence EIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFAQLQSLRCLWIEGNFLRRF
Gene ID - Mouse ENSMUSG00000090291
Gene ID - Rat ENSRNOG00000030180
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LRRC10B pAb (ATL-HPA047619)
Datasheet Anti LRRC10B pAb (ATL-HPA047619) Datasheet (External Link)
Vendor Page Anti LRRC10B pAb (ATL-HPA047619) at Atlas Antibodies

Documents & Links for Anti LRRC10B pAb (ATL-HPA047619)
Datasheet Anti LRRC10B pAb (ATL-HPA047619) Datasheet (External Link)
Vendor Page Anti LRRC10B pAb (ATL-HPA047619)